PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S00095.80
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family G2-like
Protein Properties Length: 339aa    MW: 37336.1 Da    PI: 7.9754
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S00095.80genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like105.23.7e-331972255
        G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                   prlrWtpeLH++Fv+a+e+LGG++kAtPk +l+lm+vkgLt++hvkSHLQ+YR+
  Jcr4S00095.80 19 PRLRWTPELHHCFVHAIERLGGQDKATPKLVLQLMDVKGLTISHVKSHLQMYRS 72
                   8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.6E-321576IPR009057Homeodomain-like
PROSITE profilePS5129412.471575IPR017930Myb domain
SuperFamilySSF466894.48E-161774IPR009057Homeodomain-like
TIGRFAMsTIGR015578.4E-241972IPR006447Myb domain, plants
PfamPF002499.7E-92071IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 339 aa     Download sequence    Send to blast
MGSCGRSGTV RQYIRSKVPR LRWTPELHHC FVHAIERLGG QDKATPKLVL QLMDVKGLTI  60
SHVKSHLQMY RSMRSDLGKQ GSESSIVVSV YALVADFVLY FPLMVLIRRS ESKILNFTYR  120
NSSLQRRQSF DDGCCVDEVK PIEESDSHFI YSTTLPSKRS RIETRSSISD KNLQCSQGIC  180
ETAMNPYFLD DYMGIREGNG NGSSGGGFRC EQTHSKPKST GFSLPQDLYS LNSFKYAVQE  240
SDFLKIAKLD HSKCKSDAEI CKPDEATGSG RAQEEEGGGC CELSLSLSLP HLPSQRSNAS  300
STSEISEAVS SYSALKDCSG SSTGKRSINL DLSIALCGT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012072409.10.0PREDICTED: uncharacterized protein LOC105634199
TrEMBLA0A067L2C00.0A0A067L2C0_JATCU; Uncharacterized protein
STRINGVIT_01s0137g00050.t011e-114(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF55393353
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14600.11e-34G2-like family protein